PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Phvul.004G171200.1
Common NamePHAVU_004G171200g
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Fabales; Fabaceae; Papilionoideae; Phaseoleae; Phaseolus
Family MYB_related
Protein Properties Length: 264aa    MW: 28814.6 Da    PI: 9.4484
Description MYB_related family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Phvul.004G171200.1genomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding43.38.5e-1489133347
                         SS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHH CS
     Myb_DNA-binding   3 rWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqky 47 
                         +WT+eE+  ++ + ++lG+g+W+ I+r   ++Rt+ q+ s+ qky
  Phvul.004G171200.1  89 PWTEEEHRTFLVGLEKLGKGDWRGISRNYVTTRTPTQVASHAQKY 133
                         8*******************************************9 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS501588.664318IPR001878Zinc finger, CCHC-type
Gene3DG3DSA:4.10.60.104.9E-4320IPR001878Zinc finger, CCHC-type
PROSITE profilePS5129418.17482138IPR017930Myb domain
SuperFamilySSF466891.64E-1784138IPR009057Homeodomain-like
TIGRFAMsTIGR015576.2E-1885136IPR006447Myb domain, plants
SMARTSM007171.2E-1086136IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.603.6E-1186132IPR009057Homeodomain-like
CDDcd001671.70E-989134No hitNo description
PfamPF002491.6E-1189133IPR001005SANT/Myb domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
GO:0008270Molecular Functionzinc ion binding
Sequence ? help Back to Top
Protein Sequence    Length: 264 aa     Download sequence    Send to blast
MGRKCSHCGN RGHNSRTCSS LRATFVGVRL FGVQLHISNS SSLTMKKSFS MDSLPLLSSP  60
SSSFSSSVGY LSDSDGLIVP PQDRKKGVPW TEEEHRTFLV GLEKLGKGDW RGISRNYVTT  120
RTPTQVASHA QKYFIRLATL NKKKRRSSLF DLVGGSSNCK SGDLVSSAKS KGEIENDVTL  180
SLLQFQETKK TDEQREDDNY CEAEAGADDE GVMWLHPQMK SSNNIAAIPD LELTLSVSKG  240
KVKTMEQTKS TPASFLLGPI SVT*
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
1141145KKKRR
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00565DAPTransfer from AT5G56840Download
Motif logo
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieveRetrieve
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankBT0977051e-132BT097705.1 Soybean clone JCVI-FLGm-16G4 unknown mRNA.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_007152917.10.0hypothetical protein PHAVU_004G171200g
TrEMBLV7C7L40.0V7C7L4_PHAVU; Uncharacterized protein
STRINGGLYMA01G00600.11e-111(Glycine max)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF32133271
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G56840.13e-47MYB_related family protein